PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_19884
Common NameKK1_020471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 309aa    MW: 34228.8 Da    PI: 7.5024
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_19884genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.28.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
    C.cajan_19884 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding39.71.1e-1268110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E + +v+++  +G++ W++Ia+ +  gRt++++k++w++
    C.cajan_19884  68 GQFSDSEGQTIVKLHSVFGNR-WSLIAAQLA-GRTDNDVKNHWNT 110
                      78999****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.617965IPR017930Myb domain
SuperFamilySSF466894.21E-2811108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002492.9E-171461IPR001005SANT/Myb domain
CDDcd001679.21E-131761No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2265116IPR009057Homeodomain-like
SMARTSM007171.3E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129418.50466116IPR017930Myb domain
PfamPF002491.1E-1068110IPR001005SANT/Myb domain
CDDcd001676.37E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDSEGQTIVK LHSVFGNRWS LIAAQLAGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL APPQAAHLAE AALGCFKDEV LHLLTRKPIN FQGQHSAAAL  180
GNSFTDYINC KPEEKDATVE NLSKAIQQEP QMMPATATFA MPVCPTMPGF QFSPASFANK  240
GDASPWGQSV CTGSTCTAMD QHSQLHEKLE EVNGAESEAT KEIRNLSNIF NSDCVVWDLP  300
ADDLINPMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-139AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146695.10.0hypothetical protein PHAVU_006G061600g
SwissprotQ7XQN11e-112MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A151UAH50.0A0A151UAH5_CAJCA; Transcription factor MYB39
STRINGGLYMA18G07960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-102myb domain protein 103